Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL3L Peptide - middle region

RPL3L Peptide - middle region

Product Specifications

UniProt

Q92901

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQMKLLPFRQKKAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XAP2 (35-2) Alexa Fluor® 488
sc-59730 AF488 200 µg/mL

XAP2 (35-2) Alexa Fluor® 488

Sign In for Pricing
View Details
SMPT
T18683 2 mg

SMPT

Sign In for Pricing
View Details
PAX6 (PAX6, AN2, Paired box protein Pax-6, Aniridia type II protein, Oculorhombin) (MaxLight 650) discontinued
039703-ML650 100 µL

PAX6 (PAX6, AN2, Paired box protein Pax-6, Aniridia type II protein, Oculorhombin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
ALDH16A1 Rabbit Monoclonal Antibody
orb2989406-01 30 µL

ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ALDH16A1 Rabbit Monoclonal Antibody
orb2989406-02 50 µL

ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ALDH16A1 Rabbit Monoclonal Antibody
orb2989406-03 100 µL

ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details