RPS6KA3 Peptide - middle region
RPS6KA3 Peptide - middle region
Product Specifications
Product Name Alternative
CLS, RSK, HU-3, RSK2, MRX19, ISPK-1, p90-RSK2, pp90RSK2, MAPKAPK1B, S6K-alpha3
UniProt
P51812
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_004577.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
122780-ML405 100 µL
AADAT (KAT2, Kynurenine/alpha-aminoadipate Aminotransferase, Mitochondrial, 2-aminoadipate Aminotransferase, 2-aminoadipate Transaminase, Alpha-aminoadipate Aminotransferase, Kynurenine Aminotransferase II, Kynurenine-oxoglutarate Aminotransferase II, Kynurenine-oxoglutarate Transaminase 2, Kynurenine-oxoglutarate Transaminase II) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
GTR14674223 96 Well
Sheep WNT1-inducible-signaling pathway protein 3 ELISA kit
Sign In for Pricing
View Details