RPS6KA3 Peptide - middle region
RPS6KA3 Peptide - middle region
Product Specifications
Product Name Alternative
CLS, RSK, HU-3, RSK2, MRX19, ISPK-1, p90-RSK2, pp90RSK2, MAPKAPK1B, S6K-alpha3
UniProt
P51812
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_004577.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx8062-50gEcoli 50 µg (E. coli)
Recombinant Clostridium Botulinum CLH_1161 Protein (aa 1-89)
Sign In for Pricing
View Details 
133151-FITC 100 µL
Serotonin Receptor 5A (5-Hydroxytryptamine 5A Receptor, 5-Hydroxytryptamine Receptor 5A, 5-HT5A, 5-HT-5A, 5HT5A Receptor, 5-HT5A Receptor, 5-HT5AR, HTR5A, MGC138226) (FITC)
Sign In for Pricing
View Details 