Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOCS4 Peptide - N-terminal region

SOCS4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SOCS7

UniProt

Q8WXH5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_543143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate
LC433001 20 µg

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Thiomorpholinosulfonyl Isatin
TRC-T344565-50MG 50 mg

5-Thiomorpholinosulfonyl Isatin

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR561610 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3231), CF640R conjugate, 0.1mg/mL
BNC403231-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3231), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Chlorobutyronitrile
TRC-C365041-10G 10 g

4-Chlorobutyronitrile

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL
BNC472488-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details