Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOCS4 Peptide - N-terminal region

SOCS4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SOCS7

UniProt

Q8WXH5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_543143.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBA3 Antibody (Biotin)
KB-7291-01 50 μL

GBA3 Antibody (Biotin)

Sign In for Pricing
View Details
GBA3 Antibody (Biotin)
KB-7291-02 100 µL

GBA3 Antibody (Biotin)

Sign In for Pricing
View Details
GBA3 Antibody (Biotin)
KB-7291-03 1 mL

GBA3 Antibody (Biotin)

Sign In for Pricing
View Details
Tide Quencher™ 4WS succinimidyl ester [TQ4WS SE]
2067-AAT 1 mg

Tide Quencher™ 4WS succinimidyl ester [TQ4WS SE]

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF740 conjugate, 0.1mg/mL
BNC741623-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/1623), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human STAMBPL1 activation kit by CRISPRa
GA111588 1 Kit

Human STAMBPL1 activation kit by CRISPRa

Sign In for Pricing
View Details