What is the catalog number for SIGMAR1 Peptide - middle region?

The catalog number for SIGMAR1 Peptide - middle region is orb2001217.

What sizes are available for SIGMAR1 Peptide - middle region?

SIGMAR1 Peptide - middle region is available in the following size(s): 100 µg.

Is SIGMAR1 Peptide - middle region in stock?

SIGMAR1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

SIGMAR1 Peptide - middle region

Product Specifications

Product Name Alternative

SRBP, ALS16, OPRS1, SR-BP, SIG-1R, SR-BP1, sigma1R, hSigmaR1

UniProt

Q99720

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001269134.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM16889V 100 µL

UPA (PLAU) Mouse Monoclonal Antibody [Clone ID: LBI6H1]

Sign In for Pricing

View Details

IN13133 500 mg

(p-Cymene) bis (mesitylcarboxylato) ruthenium (II)

Sign In for Pricing

View Details

orb2675995-01 50 µL

LILRA4 Antibody

Sign In for Pricing

View Details

orb2675995-02 100 µL

LILRA4 Antibody

Sign In for Pricing

View Details

orb2675995-03 200 µL

LILRA4 Antibody

Sign In for Pricing

View Details

MBS8318947-01 10 nmol

mmu-miR-20a-3p miRNA Antagomir

Sign In for Pricing

View Details