Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300A Peptide - middle region

CD300A Peptide - middle region

Product Specifications

Product Name Alternative

IRC1, IRC2, CLM-8, IRp60, IGSF12, CMRF35H, CMRF-35H, CMRF35-H, CMRF35H9, CMRF35-H9, IRC1/IRC2, CMRF-35-H9

UniProt

Q9UGN4

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001243770.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXPH1 (Neurexophilin-1, Neurexophilin 1)
487434 100 µL

NXPH1 (Neurexophilin-1, Neurexophilin 1)

Sign In for Pricing
View Details
FAK discontinued
536208-01 30ul

FAK discontinued

Sign In for Pricing
View Details
FAK discontinued
536208-02 100 µL

FAK discontinued

Sign In for Pricing
View Details
Albumin, Pigeon (FITC) discontinued
A1327-58-FITC 100 µL

Albumin, Pigeon (FITC) discontinued

Sign In for Pricing
View Details
EPX Antibody
DF15679-01 100 µL

EPX Antibody

Sign In for Pricing
View Details
EPX Antibody
DF15679-02 200 µL

EPX Antibody

Sign In for Pricing
View Details