CD300A Peptide - middle region
CD300A Peptide - middle region
Product Specifications
Product Name Alternative
IRC1, IRC2, CLM-8, IRp60, IGSF12, CMRF35H, CMRF-35H, CMRF35-H, CMRF35H9, CMRF35-H9, IRC1/IRC2, CMRF-35-H9
UniProt
Q9UGN4
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001243770.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYAN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A04755-2-Dylight594 100 µg
Anti-SERBP1 Antibody Picoband®, Dylight594 Conjugate
Sign In for Pricing
View Details MBS1454484-01 0.02 mg (E-Coli)
Recombinant Shewanella sp. Enolase-phosphatase E1 (mtnC)
Sign In for Pricing
View Details MBS1454484-02 0.1 mg (E-Coli)
Recombinant Shewanella sp. Enolase-phosphatase E1 (mtnC)
Sign In for Pricing
View Details MBS1454484-03 0.02 mg (Yeast)
Recombinant Shewanella sp. Enolase-phosphatase E1 (mtnC)
Sign In for Pricing
View Details MBS1454484-04 0.1 mg (Yeast)
Recombinant Shewanella sp. Enolase-phosphatase E1 (mtnC)
Sign In for Pricing
View Details