Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB2 Peptide - middle region

MOB2 Peptide - middle region

Product Specifications

Product Name Alternative

HCCA2

UniProt

Q70IA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001165694.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM29A Rabbit Polyclonal Antibody
orb513356 100 µg

FAM29A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD86 Polyclonal Antibody
MBS2541785-01 0.02 mL

CD86 Polyclonal Antibody

Sign In for Pricing
View Details
CD86 Polyclonal Antibody
MBS2541785-02 0.06 mL

CD86 Polyclonal Antibody

Sign In for Pricing
View Details
CD86 Polyclonal Antibody
MBS2541785-03 0.12 mL

CD86 Polyclonal Antibody

Sign In for Pricing
View Details
CD86 Polyclonal Antibody
MBS2541785-04 0.2 mL

CD86 Polyclonal Antibody

Sign In for Pricing
View Details
CD86 Polyclonal Antibody
MBS2541785-05 5x 0.2 mL

CD86 Polyclonal Antibody

Sign In for Pricing
View Details