What is the catalog number for SLC29A4 Peptide - N-terminal region?

The catalog number for SLC29A4 Peptide - N-terminal region is orb2001211.

What sizes are available for SLC29A4 Peptide - N-terminal region?

SLC29A4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is SLC29A4 Peptide - N-terminal region in stock?

SLC29A4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SLC29A4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ENT4, PMAT

UniProt

Q7RTT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001035751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDEPVPDDRYHAIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

76-549 0.1 mg

CD45.1 Antibody [A20] (APC-Cy7)

Sign In for Pricing

View Details

MBS284331-01 48 Tests

Bovine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing

View Details

MBS284331-02 96 Tests

Bovine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing

View Details

MBS284331-03 5x 96 Tests

Bovine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing

View Details

MBS284331-04 10x 96 Tests

Bovine Interleukin 16 (IL16) ELISA Kit

Sign In for Pricing

View Details

K1071102 1.0 µg DNA

IGLVVI-25-1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing

View Details