Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC29A4 Peptide - N-terminal region

SLC29A4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ENT4, PMAT

UniProt

Q7RTT9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001035751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVMSFTFDSHQLEEAAEAAQGQGLRARGVPAFTDTTLDEPVPDDRYHAIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC6 Knockout A549 Polyclonal Cells
ARG35617 1 Million

HDAC6 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
LZM Antibody
OACD05395-1ML 1 mL

LZM Antibody

Sign In for Pricing
View Details
RBM5, NT (RBM5, RNA-binding protein 5, Protein G15, Putative tumor suppressor LUCA15, RNA-binding motif protein 5, Renal carcinoma antigen NY-REN-9) (FITC) discontinued
040901-FITC 200 µL

RBM5, NT (RBM5, RNA-binding protein 5, Protein G15, Putative tumor suppressor LUCA15, RNA-binding motif protein 5, Renal carcinoma antigen NY-REN-9) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Transmembrane protein 119, Tmem119 ELISA KIT
ELI-28953m 96 Tests

Mouse Transmembrane protein 119, Tmem119 ELISA KIT

Sign In for Pricing
View Details
Recombinant Human Immunoglobulin superfamily member 2 (CD101) , partial
MBS1450361 Inquire

Recombinant Human Immunoglobulin superfamily member 2 (CD101) , partial

Sign In for Pricing
View Details
Tracheloside
MBS3608428-01 5 mg

Tracheloside

Sign In for Pricing
View Details