Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB1 Peptide - middle region

TUBB1 Peptide - middle region

Product Specifications

UniProt

Q9H4B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_110400.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGSN (NM_016571) Human Recombinant Protein
TP320287 20 µg

LGSN (NM_016571) Human Recombinant Protein

Sign In for Pricing
View Details
25-Hydroxy Cholesterol
TRC-H918030-5MG 5 mg

25-Hydroxy Cholesterol

Sign In for Pricing
View Details
Claudin 3 (CLDN3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]
CF806232 100 µg

Claudin 3 (CLDN3) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2162), CF568 conjugate, 0.1mg/mL
BNC682162-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2162), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cusatuzumab Biosimilar - Research Grade
ICH5037-5mg 5 mg

Cusatuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
4-Hydroxy-1-(3-pyridyl)-1-butanone
TRC-H953000-5MG 5 mg

4-Hydroxy-1-(3-pyridyl)-1-butanone

Sign In for Pricing
View Details