Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB1 Peptide - middle region

TUBB1 Peptide - middle region

Product Specifications

UniProt

Q9H4B7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_110400.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

-25°C Upright Freezer BFUR-25-503
BFUR-25-503 1 Unit

-25°C Upright Freezer BFUR-25-503

Sign In for Pricing
View Details
Quinoxyfen
TRC-Q765500-250MG 250 mg

Quinoxyfen

Sign In for Pricing
View Details
Timd2 Mouse Gene Knockout Kit (CRISPR)
KN517568 1 Kit

Timd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,6-Hexanediol bis[3-(3,5-di-tert-butyl-4-hydroxyphenyl)propionate]
TRC-H296885-10MG 10 mg

1,6-Hexanediol bis[3-(3,5-di-tert-butyl-4-hydroxyphenyl)propionate]

Sign In for Pricing
View Details
PDGFB Antibody
KC-19026-01 50 μL

PDGFB Antibody

Sign In for Pricing
View Details
PDGFB Antibody
KC-19026-02 100 µL

PDGFB Antibody

Sign In for Pricing
View Details