Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP1 Peptide - C-terminal region

ACAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CENTB1

UniProt

Q15027

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055531.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-01 0.02 mg (E-Coli)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-02 0.1 mg (E-Coli)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-03 0.02 mg (Yeast)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-04 0.1 mg (Yeast)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-05 0.02 mg (Baculovirus)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)
MBS1063454-06 0.02 mg (Mammalian-Cell)

Recombinant Dictyoglomus thermophilum Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details