Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAP1 Peptide - C-terminal region

ACAP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CENTB1

UniProt

Q15027

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055531.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVTLLRLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Voges-Proskauer I Reagent 10mL
MIC6726 1 Each

Voges-Proskauer I Reagent 10mL

Sign In for Pricing
View Details
Pentamethonium iodide
T202195-01 10 mg

Pentamethonium iodide

Sign In for Pricing
View Details
Pentamethonium iodide
T202195-02 50 mg

Pentamethonium iodide

Sign In for Pricing
View Details
KpnI, 1000U
RV1286 1000 U

KpnI, 1000U

Sign In for Pricing
View Details
Recombinant Human CD40/TNFRSF5 Protein, C-Fc (Active)
AHD68902 100 μg

Recombinant Human CD40/TNFRSF5 Protein, C-Fc (Active)

Sign In for Pricing
View Details
PTLCV2-U6-NNMT-sgRNA3-Cas9-EGFP-EF1a-Puro Plasmid
PVT79840 2 µg

PTLCV2-U6-NNMT-sgRNA3-Cas9-EGFP-EF1a-Puro Plasmid

Sign In for Pricing
View Details