Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PJA1 Peptide - middle region

PJA1 Peptide - middle region

Product Specifications

Product Name Alternative

RNF70, PRAJA1

UniProt

Q8NG27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001027568.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SEGDNDSGHELMQPGVFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUS7L (NM_001098615) Human Over-expression Lysate
LY420642 100 µg

PUS7L (NM_001098615) Human Over-expression Lysate

Sign In for Pricing
View Details
FABP4 Mouse Monoclonal Antibody [Clone ID: 3F4]
AM09048PU-N 100 µL

FABP4 Mouse Monoclonal Antibody [Clone ID: 3F4]

Sign In for Pricing
View Details
Human C11orf96 activation kit by CRISPRa
GA117908 1 Kit

Human C11orf96 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS805914 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: OTI2C7]
CF813471 100 µg

IL2 Receptor alpha (IL2RA) Mouse Monoclonal Antibody [Clone ID: OTI2C7]

Sign In for Pricing
View Details
Mouse IL-6R (Interleukin 6 Receptor) ELISA Kit
E-EL-M2453-01 24 Tests

Mouse IL-6R (Interleukin 6 Receptor) ELISA Kit

Sign In for Pricing
View Details