RANBP10 Peptide - middle region
RANBP10 Peptide - middle region
Product Specifications
UniProt
Q6VN20
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_065901.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKCRQFVEMVNGTDSEVRSLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4243706 1.0 µg DNA
Olfr843 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
48110091 4x 500 ng
TRNAK14-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details 
orb2985970-01 20 µg
Recombinant Human Melanoma-associated antigen 2 (MAGEA2; MAGEA2B)
Sign In for Pricing
View Details orb2985970-02 100 µg
Recombinant Human Melanoma-associated antigen 2 (MAGEA2; MAGEA2B)
Sign In for Pricing
View Details orb2985970-03 1 mg
Recombinant Human Melanoma-associated antigen 2 (MAGEA2; MAGEA2B)
Sign In for Pricing
View Details