RANBP10 Peptide - middle region
RANBP10 Peptide - middle region
Product Specifications
UniProt
Q6VN20
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_065901.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LKCRQFVEMVNGTDSEVRSLSSRSPKSQDSYPGSPSLSPRHGPSSSHMHN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7250853-01 48 Well
Mouse Krueppel-like factor 9 (KLF9) ELISA Kit
Sign In for Pricing
View Details MBS7250853-02 96 Well
Mouse Krueppel-like factor 9 (KLF9) ELISA Kit
Sign In for Pricing
View Details MBS7250853-03 5x 96 Well
Mouse Krueppel-like factor 9 (KLF9) ELISA Kit
Sign In for Pricing
View Details MBS7250853-04 10x 96 Well
Mouse Krueppel-like factor 9 (KLF9) ELISA Kit
Sign In for Pricing
View Details 
TRV-0057095-01 20 µL
Polyclonal Antibody to Protease Activated Receptor 2 (PAR2)
Sign In for Pricing
View Details