Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF208 Peptide - middle region

RNF208 Peptide - middle region

Product Specifications

UniProt

Q9H0X6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112587.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WPSDTEIIVNQACGGDMPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isoguanosine Hydrate (Crotonoside, 2-Hydroxyadenosine)
MBS6103273-01 100 mg

Isoguanosine Hydrate (Crotonoside, 2-Hydroxyadenosine)

Sign In for Pricing
View Details
Isoguanosine Hydrate (Crotonoside, 2-Hydroxyadenosine)
MBS6103273-02 5x 100 mg

Isoguanosine Hydrate (Crotonoside, 2-Hydroxyadenosine)

Sign In for Pricing
View Details
Formamidine acetate
FF38201-01 2 Kg

Formamidine acetate

Sign In for Pricing
View Details
Formamidine acetate
FF38201-02 5 Kg

Formamidine acetate

Sign In for Pricing
View Details
ATF7 Recombinant Antibody, APC Conjugated
bsm-61320R-APC-TR 20 µL

ATF7 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
2-Ethyl-4-Methyl-1H-Imidazole
E7650-01 25 g

2-Ethyl-4-Methyl-1H-Imidazole

Sign In for Pricing
View Details