Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF208 Peptide - middle region

RNF208 Peptide - middle region

Product Specifications

UniProt

Q9H0X6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_112587.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WPSDTEIIVNQACGGDMPALEGAPHTPPLPRRPRKGSSELGFPRVAPEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF6L Rabbit Polyclonal Antibody (HRP)
orb2128439 100 µL

TAF6L Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PTBP1 CytoSection
TS402564P5 25 Slides

PTBP1 CytoSection

Sign In for Pricing
View Details
FBXL17 (NM_022824) Human Tagged ORF Clone
RG219715 10 µg

FBXL17 (NM_022824) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans ZK688.5 Polyclonal Antibody
MBS7155295 Inquire

Rabbit anti-Caenorhabditis elegans ZK688.5 Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF512B qPCR Primer Pair
QH47937S 200 Tests

Human ZNF512B qPCR Primer Pair

Sign In for Pricing
View Details
IL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV675411 1.0 µg DNA

IL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details