Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHC2 Peptide - middle region

SHC2 Peptide - middle region

Product Specifications

Product Name Alternative

SCK, SLI, SHCB

UniProt

P98077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_036567.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDAPEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAS16 Protein Vector (Human) (pPM-C-HA)
PV140160 500 ng

TRNAS16 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Casp1 Pre-designed siRNA Set A
SI201999A 1 Each

Rat Casp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-CREB1-S129 polyclonal antibody
BS79454-01 50 µL

Phospho-CREB1-S129 polyclonal antibody

Sign In for Pricing
View Details
Phospho-CREB1-S129 polyclonal antibody
BS79454-02 100 µL

Phospho-CREB1-S129 polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 63 (ANKRD63)
MBS1217766-01 0.02 mg (E-Coli)

Recombinant Human Ankyrin repeat domain-containing protein 63 (ANKRD63)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat domain-containing protein 63 (ANKRD63)
MBS1217766-02 0.02 mg (Yeast)

Recombinant Human Ankyrin repeat domain-containing protein 63 (ANKRD63)

Sign In for Pricing
View Details