Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP8 Peptide - middle region

CASP8 Peptide - middle region

Product Specifications

Product Name Alternative

CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8

UniProt

Q14790

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASP8 Rabbit Polyclonal Antibody (orb584149) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073594.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)
MBS2099580-01 5x 96 Tests

Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)
MBS2099580-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)
MBS2099580-03 10x 96 Tests

Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)
MBS2099580-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine Complement Component 3 (C3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
ephrin-B3 Lentiviral Activation Particles (h2)
sc-402767-LAC-2 200 µL

ephrin-B3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
GRHPR (Glyoxylate Reductase/Hydroxypyruvate Reductase, GLXR, MSTP035) (PE)
MBS6158070-01 0.1 mL

GRHPR (Glyoxylate Reductase/Hydroxypyruvate Reductase, GLXR, MSTP035) (PE)

Sign In for Pricing
View Details