ISG20 Peptide - C-terminal region
ISG20 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD25, HEM45
UniProt
Q96AZ6
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ISG20 Rabbit Polyclonal Antibody (orb584216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002192
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-SOCS3-Ra-01 96 Tests
Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit
Sign In for Pricing
View Details RDR-SOCS3-Ra-02 48 Tests
Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit
Sign In for Pricing
View Details 
TRC-D494867-10MG 10 mg
DOTA-NHS-ester Hexafluorophosphate TFA Salt (Technical Grade)
Sign In for Pricing
View Details 
