ANXA8L2 Peptide - middle region
ANXA8L2 Peptide - middle region
Product Specifications
Product Name Alternative
ANXA8, bA145E20.2
UniProt
P13928
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANXA8L2 Rabbit Polyclonal Antibody (orb588556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035173.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1683903 1.0 µg DNA
POLR2J2 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
NBP3-28089JF525 0.1 mL
Human Monoclonal FZR1/CDH1 Antibody (Stem Centrx patent anti-Cadherin-1) [Janelia Fluor 525]
Sign In for Pricing
View Details orb1610801 100 µL
Ferredoxin Reductase Rabbit Polyclonal Antibody (BF488)
Sign In for Pricing
View Details