ANXA8L2 Peptide - middle region
ANXA8L2 Peptide - middle region
Product Specifications
Product Name Alternative
ANXA8, bA145E20.2
UniProt
P13928
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANXA8L2 Rabbit Polyclonal Antibody (orb588556) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001035173.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RILVCLLQGSRDDVSSFVDPGLALQDAQDLYAAGEKIRGTDEMKFITILC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP98359 50 µg
Recombinant Influenza A virus (H3N2) HA/Hemagglutinin Protein, C-His
Sign In for Pricing
View Details 
RC213413L4 10 µg
KIAA1024 (MINAR1) (NM_015206) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details orb1097615-01 50 μL
P70 S6 kinase α (phospho Ser371) Polyclonal Antibody
Sign In for Pricing
View Details orb1097615-02 100 µL
P70 S6 kinase α (phospho Ser371) Polyclonal Antibody
Sign In for Pricing
View Details