Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA8L2 Peptide - middle region

ANXA8L2 Peptide - middle region

Product Specifications

Product Name Alternative

ANXA8, bA145E20.2

UniProt

Q5VT79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANXA8L2 Rabbit Polyclonal Antibody (orb55746) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092315.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RILVCLLQGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B Recombinant Protein (Human)
RP030358 100 µg

STAT5B Recombinant Protein (Human)

Sign In for Pricing
View Details
Angiotensin II (3-8), human (TFA)
HY-P1515A-01 5 mg

Angiotensin II (3-8), human (TFA)

Sign In for Pricing
View Details
Angiotensin II (3-8), human (TFA)
HY-P1515A-02 10 mg

Angiotensin II (3-8), human (TFA)

Sign In for Pricing
View Details
Angiotensin II (3-8), human (TFA)
HY-P1515A-03 25 mg

Angiotensin II (3-8), human (TFA)

Sign In for Pricing
View Details
ATP6V0E1P2 Protein Vector (Human) (pPM-C-HA)
PV064003 500 ng

ATP6V0E1P2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)
MBS1190820-01 0.02 mg (E-Coli)

Recombinant Bartonella tribocorum Glutamate--tRNA ligase 1 (gltX1)

Sign In for Pricing
View Details