Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA6 Peptide - middle region

CA6 Peptide - middle region

Product Specifications

Product Name Alternative

CA-VI, GUSTIN

UniProt

P23280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA6 Rabbit Polyclonal Antibody (orb55748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001206.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAU1 Protein Vector (Rat) (pPM-C-HA)
45703027 500 ng

STAU1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Alpha-Synuclein Monoclonal Antibody, AbBy Fluor™ 594 Conjugated
bsm-0968M-BF594 100 µL

Alpha-Synuclein Monoclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
SETDB2 siRNA (Mouse)
CRN3398-01 15 nmol

SETDB2 siRNA (Mouse)

Sign In for Pricing
View Details
SETDB2 siRNA (Mouse)
CRN3398-02 30 nmol

SETDB2 siRNA (Mouse)

Sign In for Pricing
View Details
Rat IgG (H&L) Antibody Texas Red Conjugated
orb347897 2 mg

Rat IgG (H&L) Antibody Texas Red Conjugated

Sign In for Pricing
View Details
Penciclovir
MBS3841747-01 50 mg

Penciclovir

Sign In for Pricing
View Details