Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA6 Peptide - middle region

CA6 Peptide - middle region

Product Specifications

Product Name Alternative

CA-VI, GUSTIN

UniProt

P23280

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA6 Rabbit Polyclonal Antibody (orb55748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001206.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DDX56 Antibody [HRP]
NBP2-97523H 0.1 mL

Rabbit Polyclonal DDX56 Antibody [HRP]

Sign In for Pricing
View Details
GDC shRNA (m) Lentiviral Particles
sc-145372-V 200 µL

GDC shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Bcl-8 (h) -PR
sc-90162-PR 10 µM - 20 µL

Bcl-8 (h) -PR

Sign In for Pricing
View Details
Mouse Monoclonal HNF-3 beta/FoxA2 Antibody (OTI3C10) [DyLight 755]
NBP2-70904IR 0.1 mL

Mouse Monoclonal HNF-3 beta/FoxA2 Antibody (OTI3C10) [DyLight 755]

Sign In for Pricing
View Details
Recombinant Solanum lycopersicum Pectinesterase 2.1 (PME2.1)
MBS1172789-01 0.02 mg (E-Coli)

Recombinant Solanum lycopersicum Pectinesterase 2.1 (PME2.1)

Sign In for Pricing
View Details
Recombinant Solanum lycopersicum Pectinesterase 2.1 (PME2.1)
MBS1172789-02 0.02 mg (Yeast)

Recombinant Solanum lycopersicum Pectinesterase 2.1 (PME2.1)

Sign In for Pricing
View Details