Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPD Peptide - middle region

CEBPD Peptide - middle region

Product Specifications

Product Name Alternative

CELF, CRP3, C/EBP-delta, NF-IL6-beta

UniProt

P49716

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEBPD Rabbit Polyclonal Antibody (orb588570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005186.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Marking Dye for Tissue - Orange
24117-2 2 oz

Marking Dye for Tissue - Orange

Sign In for Pricing
View Details
C7orf45 Rabbit Polyclonal Antibody (BF350)
orb2507874 100 µL

C7orf45 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Sheep Cytochrome-C, Cyt-C ELISA Kit
GTR10451831 96 Well

Sheep Cytochrome-C, Cyt-C ELISA Kit

Sign In for Pricing
View Details
Porcine 14 3 3 protein β/Alpha (YWHAB) ELISA kit
GTR10471671 96 Well

Porcine 14 3 3 protein β/Alpha (YWHAB) ELISA kit

Sign In for Pricing
View Details
Human BMP2, InVivo Block/Neutralizing Antibody
ANT-37273-1mg 1 mg

Human BMP2, InVivo Block/Neutralizing Antibody

Sign In for Pricing
View Details
PLK5 Polyclonal Antibody
bs-7918R 100 µL

PLK5 Polyclonal Antibody

Sign In for Pricing
View Details