Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPD Peptide - middle region

CEBPD Peptide - middle region

Product Specifications

Product Name Alternative

CELF, CRP3, C/EBP-delta, NF-IL6-beta

UniProt

P49716

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEBPD Rabbit Polyclonal Antibody (orb588570) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005186.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Olfactory receptor 51Q1 (OR51Q1) ELISA kit
GTR10420086 96 Well

Rat Olfactory receptor 51Q1 (OR51Q1) ELISA kit

Sign In for Pricing
View Details
Human Prostaglandin reductase 1 (PTGR1) ELISA kit
GTR10442494 96 Well

Human Prostaglandin reductase 1 (PTGR1) ELISA kit

Sign In for Pricing
View Details
NLRP3 Antibody
E38PA5260 100 µL

NLRP3 Antibody

Sign In for Pricing
View Details
QuicKey Pro Monkey E3 (Estriol) ELISA Kit
MBS2568104-01 24 Tests (Limit 1)

QuicKey Pro Monkey E3 (Estriol) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Monkey E3 (Estriol) ELISA Kit
MBS2568104-02 48 Tests

QuicKey Pro Monkey E3 (Estriol) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Monkey E3 (Estriol) ELISA Kit
MBS2568104-03 96 Tests

QuicKey Pro Monkey E3 (Estriol) ELISA Kit

Sign In for Pricing
View Details