CSNK1E Peptide - middle region
CSNK1E Peptide - middle region
Product Specifications
Product Name Alternative
CKIe, HCKIE, CKIepsilon
UniProt
P49674
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSNK1E Rabbit Polyclonal Antibody (orb55751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001276841.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSAT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GAF-351-40 1 mL
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA, 40nm
Sign In for Pricing
View Details ![C4orf36 Mouse Monoclonal Antibody [Clone ID: OTI8B7]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9082ca/imageurl/cf808287.webp)
CF808287 100 µg
C4orf36 Mouse Monoclonal Antibody [Clone ID: OTI8B7]
Sign In for Pricing
View Details 
BNC402247-500 1x 500 µL
NME1 / nm23-H1 / NDPK-A (Suppressor of Metastasis) (CPTC-NME1-2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 