Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2A7 Peptide - N-terminal region

CYP2A7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPA7, CPAD, CYP2A, CYPIIA7, P450-IIA4

UniProt

Q16696

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2A7 Rabbit Polyclonal Antibody (orb55752) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000755.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amplite® Blue
11005-AAT 25 mg

Amplite® Blue

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783H-01 25 µg

PE/Cyanine7 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, κ Isotype Control[MM-30]
E-AB-F09783H-02 100 µg

PE/Cyanine7 Mouse IgM, κ Isotype Control[MM-30]

Sign In for Pricing
View Details
Human MCCD1 activation kit by CRISPRa
GA118317 1 Kit

Human MCCD1 activation kit by CRISPRa

Sign In for Pricing
View Details
SMARCC1 (NM_003074) Human Recombinant Protein
TP308534L 1 mg

SMARCC1 (NM_003074) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CyCMV (strain OT-1) glycoprotein B / GB Protein (Fc Tag)
PKSV030234 100 µg

Recombinant CyCMV (strain OT-1) glycoprotein B / GB Protein (Fc Tag)

Sign In for Pricing
View Details