Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ogn Peptide - N-terminal region

Ogn Peptide - N-terminal region

Product Specifications

Product Name Alternative

OG, OIF, SLRR3A, mimecan, mimican, 3110079A16Rik

UniProt

D3ZVB7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OGN Rabbit Polyclonal Antibody (orb588650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032786.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLFVPLTQQAPQSQLDSHVNYEYATGNSEETKFSQDYEDKYLDGKSIKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNND1 Antibody
KC-247-01 50 μL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
KC-247-02 100 µL

CTNND1 Antibody

Sign In for Pricing
View Details
CTNND1 Antibody
KC-247-03 1 mL

CTNND1 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561050 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Accuris™ UV Transilluminator, 21x26cm, Variable Intensity, 230V
E3200-E 1 Each

Accuris™ UV Transilluminator, 21x26cm, Variable Intensity, 230V

Sign In for Pricing
View Details
5-HT (Serotonin) Recombinant Rabbit monoclonal Antibody
HA751044 100 µL

5-HT (Serotonin) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details