Ogn Peptide - N-terminal region
Ogn Peptide - N-terminal region
Product Specifications
Product Name Alternative
OG, OIF, SLRR3A, mimecan, mimican, 3110079A16Rik
UniProt
D3ZVB7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OGN Rabbit Polyclonal Antibody (orb588650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032786.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLFVPLTQQAPQSQLDSHVNYEYATGNSEETKFSQDYEDKYLDGKSIKEK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403642-100 1x 100 µL
ATG5 (Autophagy Marker) (rATG5/2553), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402714-100 1x 100 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472620-500 1x 500 µL
Cyclin D2 (CCND2/2620), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details