Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdha1 Peptide - middle region

Pdha1 Peptide - middle region

Product Specifications

Product Name Alternative

Pdha-1

UniProt

P35486

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDHA1 Rabbit Polyclonal Antibody (orb588655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B3GNT9 (NM_033309) AAV Particle
RC204295A1V 250 µL

Human B3GNT9 (NM_033309) AAV Particle

Sign In for Pricing
View Details
ST6Gal Rabbit Polyclonal Antibody
TA354751 100 µg

ST6Gal Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
REV3L Protein Vector (Rat) (pPB-C-His)
PV298846 500 ng

REV3L Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human H6PD Protein, N-His
HF993012-01 50 µg

Recombinant Human H6PD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human H6PD Protein, N-His
HF993012-02 100 µg

Recombinant Human H6PD Protein, N-His

Sign In for Pricing
View Details
Recombinant Human H6PD Protein, N-His
HF993012-03 1 mg

Recombinant Human H6PD Protein, N-His

Sign In for Pricing
View Details