Pdha1 Peptide - middle region
Pdha1 Peptide - middle region
Product Specifications
Product Name Alternative
Pdha-1
UniProt
P35486
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDHA1 Rabbit Polyclonal Antibody (orb588655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032836.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV660054 1.0 µg DNA
IGFALS Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
K3305406 1.0 µg DNA
4930578I06Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details MBS1467425-01 0.02 mg (E-Coli)
Recombinant Oryza sativa subsp. japonica Homeobox-leucine zipper protein HOX21 (HOX21)
Sign In for Pricing
View Details MBS1467425-02 0.02 mg (Yeast)
Recombinant Oryza sativa subsp. japonica Homeobox-leucine zipper protein HOX21 (HOX21)
Sign In for Pricing
View Details MBS1467425-03 0.1 mg (E-Coli)
Recombinant Oryza sativa subsp. japonica Homeobox-leucine zipper protein HOX21 (HOX21)
Sign In for Pricing
View Details MBS1467425-04 0.1 mg (Yeast)
Recombinant Oryza sativa subsp. japonica Homeobox-leucine zipper protein HOX21 (HOX21)
Sign In for Pricing
View Details