Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou5f1 Peptide - C-terminal region

Pou5f1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Oct3, Oct4, Otf3, Otf4, NF-A3, Oct-3, Oct-4, Otf-3, Otf-4, Otf3g, Oct3/4, Oct-3/4, Otf3-rs7

UniProt

P20263

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POU5F1 Rabbit Polyclonal Antibody (orb588661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038661.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAF7 Protein Vector (Human) (pPB-N-His)
PV072310 500 ng

DCAF7 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lurap1l (NM_001025022) Rat Untagged Clone
RN204307 10 µg

Lurap1l (NM_001025022) Rat Untagged Clone

Sign In for Pricing
View Details
Rat Surfactant Associated Protein A (SPA) ELISA Kit
BSKR62921-01 48 Tests

Rat Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
Rat Surfactant Associated Protein A (SPA) ELISA Kit
BSKR62921-02 96 Tests

Rat Surfactant Associated Protein A (SPA) ELISA Kit

Sign In for Pricing
View Details
Anti-Human HCG Beta (Clone 208) -HRP
12-8309-1.0 1 mL

Anti-Human HCG Beta (Clone 208) -HRP

Sign In for Pricing
View Details
RPMI 1640 Medium w/o L-Glutamine (Powder)
MBS652739-01 10 L

RPMI 1640 Medium w/o L-Glutamine (Powder)

Sign In for Pricing
View Details