Cacng3 Peptide - middle region
Cacng3 Peptide - middle region
Product Specifications
UniProt
Q9JJV5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CACNG3 Rabbit Polyclonal Antibody (orb588755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062303.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx356819 96 Well
Chicken Phenylalanine Hydroxylase (PAH) ELISA Kit
Sign In for Pricing
View Details ELI-43103m 96 Tests
Mouse U6 snRNA-associated Sm-like protein LSm2, Lsm2 ELISA KIT
Sign In for Pricing
View Details 
ENZ-ABS332-0100 100 µg
Von Willebrand Factor Recombinant monoclonal antibody (VWF/1859R)
Sign In for Pricing
View Details