Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng3 Peptide - middle region

Cacng3 Peptide - middle region

Product Specifications

UniProt

Q9JJV5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CACNG3 Rabbit Polyclonal Antibody (orb588755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062303.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEKHQQLRARSHSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD142 Antibody
MBS9240954-01 0.05 mL

Anti-CD142 Antibody

Sign In for Pricing
View Details
Anti-CD142 Antibody
MBS9240954-02 0.1 mL

Anti-CD142 Antibody

Sign In for Pricing
View Details
Anti-CD142 Antibody
MBS9240954-03 5x 0.1 mL

Anti-CD142 Antibody

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]
TA503610AM 100 µL

Acetyl CoA synthetase (ACSS2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]

Sign In for Pricing
View Details
CDS1 Protein Vector (Rat) (pPB-N-His)
PV259211 500 ng

CDS1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Polyclonal SEMA3D Antibody
H00223117-B01P 50 µg

Mouse Polyclonal SEMA3D Antibody

Sign In for Pricing
View Details