Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St3gal6 Peptide - middle region

St3gal6 Peptide - middle region

Product Specifications

Product Name Alternative

Siat10, AI930218, AW552396, St3galVI, 1700023B24Rik

UniProt

Q8VIB3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ST3GAL6 Rabbit Polyclonal Antibody (orb588757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061254.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FWKTPALKLIYKQYQIRILDPYITSEAAFQMLRFPRVFPKDQKPKHPTTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RISC Lentiviral Activation Particles (m)
sc-428945-LAC 200 µL

RISC Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Rabbit anti-POTEB Antibody
MBS4507363-01 0.05 mL

Rabbit anti-POTEB Antibody

Sign In for Pricing
View Details
Rabbit anti-POTEB Antibody
MBS4507363-02 0.1 mL

Rabbit anti-POTEB Antibody

Sign In for Pricing
View Details
Rabbit anti-POTEB Antibody
MBS4507363-03 5x 0.1 mL

Rabbit anti-POTEB Antibody

Sign In for Pricing
View Details
Cd2 Rat Monoclonal Antibody [Clone ID: 12-15]
AM08025LE-N 500 µg

Cd2 Rat Monoclonal Antibody [Clone ID: 12-15]

Sign In for Pricing
View Details
HERC5 Rabbit pAb
orb2713363-01 50 µL

HERC5 Rabbit pAb

Sign In for Pricing
View Details