St3gal6 Peptide - middle region
St3gal6 Peptide - middle region
Product Specifications
Product Name Alternative
Siat10, AI930218, AW552396, St3galVI, 1700023B24Rik
UniProt
Q8VIB3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ST3GAL6 Rabbit Polyclonal Antibody (orb588757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_061254.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FWKTPALKLIYKQYQIRILDPYITSEAAFQMLRFPRVFPKDQKPKHPTTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
123098-ML650 100 µL
AHSG (Alpha-2-HS-Glycoprotein, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, Fetuin-A, FETUA, PRO2743) (MaxLight 650)
Sign In for Pricing
View Details I1661 96 Tests
UV excision repair protein RAD23 homolog B (RAD23B) Bovine ELISA Kit
Sign In for Pricing
View Details OR1040971-01 100 mg
Carboxyethyl-?-aminobutyric acid (hydrochloride)
Sign In for Pricing
View Details