Trex1 Peptide - middle region
Trex1 Peptide - middle region
Product Specifications
Product Name Alternative
AU041952
UniProt
Q91XB0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TREX1 Rabbit Polyclonal Antibody (orb588785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
AAH11133.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FCVDSIAALKALEQASSPSGNGSRKSYSLGSIYTRLYWQAPTDSHTAEGD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941505-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742837-500 1x 500 µL
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
