Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN2 Peptide - middle region

RCN2 Peptide - middle region

Product Specifications

Product Name Alternative

E6BP, ERC55, ERC-55, TCBP49

UniProt

Q14257

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCN2 Rabbit Polyclonal Antibody (orb589060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001258766.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELOVL6 AAV Vector (Human) (CMV)
19238101 1 µg

ELOVL6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PRKG1 Antibody
OAAN00899-200UL 200 µL

PRKG1 Antibody

Sign In for Pricing
View Details
PDE4C Double Nickase Plasmid (m)
sc-431020-NIC 20 µg

PDE4C Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Rno-miR-377-3p mimic
HY-R04449-01 5 nmol

Rno-miR-377-3p mimic

Sign In for Pricing
View Details
Rno-miR-377-3p mimic
HY-R04449-02 20 nmol

Rno-miR-377-3p mimic

Sign In for Pricing
View Details
Prezalumab Biosimilar (Monoclonal, IgG2)
A137771 100 µL

Prezalumab Biosimilar (Monoclonal, IgG2)

Sign In for Pricing
View Details