Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLCE Peptide - middle region

GLCE Peptide - middle region

Product Specifications

Product Name Alternative

HSEPI

UniProt

O94923

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLCE Rabbit Polyclonal Antibody (orb589069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056369.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETAEDRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TK1 (Thymidine Kinase 1, Soluble, TK2) (AP)
MBS6163968-01 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (AP)

Sign In for Pricing
View Details
TK1 (Thymidine Kinase 1, Soluble, TK2) (AP)
MBS6163968-02 5x 0.1 mL

TK1 (Thymidine Kinase 1, Soluble, TK2) (AP)

Sign In for Pricing
View Details
Adrenergic Receptor, Alpha 2c
MBS610327-01 0.1 mg

Adrenergic Receptor, Alpha 2c

Sign In for Pricing
View Details
Adrenergic Receptor, Alpha 2c
MBS610327-02 5x 0.1 mg

Adrenergic Receptor, Alpha 2c

Sign In for Pricing
View Details
Beclin 1 Blocking Peptide
33R-10861 50 ug

Beclin 1 Blocking Peptide

Sign In for Pricing
View Details
rac trans-4-Cotinine Carboxylic Acid
TRC-C725150-250MG 250 mg

rac trans-4-Cotinine Carboxylic Acid

Sign In for Pricing
View Details