Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA10 Peptide - middle region

NDUFA10 Peptide - middle region

Product Specifications

Product Name Alternative

CI-42k, CI-42KD

UniProt

O95299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA10 Rabbit Polyclonal Antibody (orb589071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004535.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiQuik™ L-Glutamate Quick Test Strips
QQGLUT10 10 Tests

QuantiQuik™ L-Glutamate Quick Test Strips

Sign In for Pricing
View Details
MYLIP Antibody
KC-30241-01 50 μL

MYLIP Antibody

Sign In for Pricing
View Details
MYLIP Antibody
KC-30241-02 100 µL

MYLIP Antibody

Sign In for Pricing
View Details
MYLIP Antibody
KC-30241-03 1 mL

MYLIP Antibody

Sign In for Pricing
View Details
Mouse Akp3 activation kit by CRISPRa
GA200148 1 Kit

Mouse Akp3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human PLA2G7/Lp-PLA2 Protein (His Tag)
PKSH031390 50 µg

Recombinant Human PLA2G7/Lp-PLA2 Protein (His Tag)

Sign In for Pricing
View Details