Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA10 Peptide - middle region

NDUFA10 Peptide - middle region

Product Specifications

Product Name Alternative

CI-42k, CI-42KD

UniProt

O95299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA10 Rabbit Polyclonal Antibody (orb589071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004535.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS14 (C-term) Rabbit Polyclonal Antibody
AP53734PU-N 400 µL

RPS14 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
H2BC4 Human Gene Knockout Kit (CRISPR)
KN417796 1 Kit

H2BC4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human BCAM Protein (Fc Tag)
PKSH031736 100 µg

Recombinant Human BCAM Protein (Fc Tag)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Metastasis, unknown source
CB617844 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
96 Well Gradient Thermal Cycler BTHC-106
BTHC-106 1 Unit

96 Well Gradient Thermal Cycler BTHC-106

Sign In for Pricing
View Details
2-[(5-Chloro-2,1,3-benzothiadiazol-4-yl)amino]-3,5-dihydro-4H-imidazol-4-one
TRC-C367045-10MG 10 mg

2-[(5-Chloro-2,1,3-benzothiadiazol-4-yl)amino]-3,5-dihydro-4H-imidazol-4-one

Sign In for Pricing
View Details