Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB1 Peptide - middle region

EPHB1 Peptide - middle region

Product Specifications

Product Name Alternative

ELK, NET, Hek6, EPHT2

UniProt

P54762

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHB1 Rabbit Polyclonal Antibody (orb588594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004432.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toll-Like Receptor 10 (TLR10) Antibody
abx320263-01 20 µL

Toll-Like Receptor 10 (TLR10) Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 10 (TLR10) Antibody
abx320263-02 50 µL

Toll-Like Receptor 10 (TLR10) Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 10 (TLR10) Antibody
abx320263-03 100 µL

Toll-Like Receptor 10 (TLR10) Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 10 (TLR10) Antibody
abx320263-04 200 µL

Toll-Like Receptor 10 (TLR10) Antibody

Sign In for Pricing
View Details
Toll-Like Receptor 10 (TLR10) Antibody
abx320263-05 1 mL

Toll-Like Receptor 10 (TLR10) Antibody

Sign In for Pricing
View Details
ALK (phospho Tyr1507) Antibody
A0611-01 50 μL

ALK (phospho Tyr1507) Antibody

Sign In for Pricing
View Details