Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EYA4 Peptide - middle region

EYA4 Peptide - middle region

Product Specifications

Product Name Alternative

CMD1J, DFNA10

UniProt

O95677

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EYA4 Rabbit Polyclonal Antibody (orb588595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001287941.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHSLLTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZUP1 Human qPCR Primer Pair (NM_145062)
HP217380 200 Reactions

ZUP1 Human qPCR Primer Pair (NM_145062)

Sign In for Pricing
View Details
CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL
BNC680773-100 1x 100 µL

CD20 (IGEL/773), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pizotifen Malate
TRC-P552803-10MG 10 mg

Pizotifen Malate

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-22 Recombinant Rabbit monoclonal Antibody
HA725031 100 µL

Mouse IL-22 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703268 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details