EYA4 Peptide - middle region
EYA4 Peptide - middle region
Product Specifications
Product Name Alternative
CMD1J, DFNA10
UniProt
O95677
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EYA4 Rabbit Polyclonal Antibody (orb588595) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001287941.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DERTCRSSGSKSRGRGRKNNPSPPPDSDLERVFVWDLDETIIVFHSLLTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040035-100 1x 100 µL
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AN302105L-01 50 µL
Recombinant Phospho-Histone H3 (Ser10) Monoclonal Antibody
Sign In for Pricing
View Details AN302105L-02 100 µL
Recombinant Phospho-Histone H3 (Ser10) Monoclonal Antibody
Sign In for Pricing
View Details 
BNC472344-100 1x 100 µL
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 