EXTL2 Peptide - middle region
EXTL2 Peptide - middle region
Product Specifications
Product Name Alternative
EXTR2
UniProt
Q9UBQ6
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EXTL2 Rabbit Polyclonal Antibody (orb588597) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001028197.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGM
More Discoveries
Explore Other Products
Browse additional items from our catalog
QY-E40156 96 Tests
Porcine interleukin-1 receptor antagonist (IL1Ra) ELISA Kit
Sign In for Pricing
View Details 
QP5236-500ug 500ug
Recombinant Human Resistin/ ADSF/ RETN Protein, Untagged, E.coli-500ug
Sign In for Pricing
View Details MBS1277652-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock
RNF25 cDNA Clone
Sign In for Pricing
View Details